PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK37573.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family WRKY
Protein Properties Length: 462aa    MW: 50315.7 Da    PI: 8.2357
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK37573.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY1023.4e-32198254259
                 --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
        WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                 dDgynWrKYGqK++kg e+prsYY+Ct+a+Cpvkkkvers+ d+++++i+Y+g+H+he
  KFK37573.1 198 DDGYNWRKYGQKPIKGCEYPRSYYKCTHANCPVKKKVERSS-DGQITQIIYKGQHDHE 254
                 8****************************************.***************8 PP

2WRKY105.13.6e-33343401159
                 ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
        WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                 ldDgy+WrKYGqK+vkg+++prsYY+Ct+a+C+v+k+ver+++d k+v++tYeg+Hnh+
  KFK37573.1 343 LDDGYRWRKYGQKVVKGNPHPRSYYKCTTANCTVRKHVERASTDAKAVITTYEGKHNHD 401
                 59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.806.7E-29189256IPR003657WRKY domain
SuperFamilySSF1182901.7E-25195256IPR003657WRKY domain
SMARTSM007742.0E-35197255IPR003657WRKY domain
PROSITE profilePS5081124.306198256IPR003657WRKY domain
PfamPF031065.4E-25198253IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.4E-36328403IPR003657WRKY domain
SuperFamilySSF1182904.18E-29335403IPR003657WRKY domain
PROSITE profilePS5081137.734338403IPR003657WRKY domain
SMARTSM007743.8E-38343402IPR003657WRKY domain
PfamPF031061.6E-25344401IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0031347Biological Processregulation of defense response
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 462 aa     Download sequence    Send to blast
MAVDEDVSSM RTTTLVAPTR PTITVPQRPP AIETPGYLFG VGDALSLSPG PLSFVSSLFA  60
DNFPDGLTPT TSFSQLLAGA MSVSPGVGGG GRSPTGIFAG PMFTIPSGFS PSSLLTSPMF  120
FPPQQAPAQN GFVQPQPQQQ PQRPDAFPHH MPPSTSTAVH GRPSFEVSQA DQRARNHHYN  180
PANNNRSYNV VNVDKPADDG YNWRKYGQKP IKGCEYPRSY YKCTHANCPV KKKVERSSDG  240
QITQIIYKGQ HDHERPQNRR GGGGVARDSS EIGDIHFVGG AGHIMESSDD SGYGKEHDDD  300
DDNDDDEDLP ASKIRKIDGV STTHRTVTEP KIIVQTRSEV DLLDDGYRWR KYGQKVVKGN  360
PHPRSYYKCT TANCTVRKHV ERASTDAKAV ITTYEGKHNH DVPAARNGTA AASAAAAGTS  420
DHNRMRSMSG NNMQQHMSFG NNNNAGQSPV LLRLKEEKMT IN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A2e-38198404878Probable WRKY transcription factor 4
1wj2_A2e-38198404878Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006297601.10.0hypothetical protein CARUB_v10013623mg
SwissprotQ93WU70.0WRK58_ARATH; Probable WRKY transcription factor 58
TrEMBLA0A087H6210.0A0A087H621_ARAAL; Uncharacterized protein
STRINGfgenesh1_pm.C_scaffold_30000980.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM156701416
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01080.10.0WRKY DNA-binding protein 58